(data stored in SCRATCH3701 zone)

EMBL: CP002031.RIMM

CP002031.RIMM        Location/Qualifiers
FT   CDS             657275..657793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="KN400_0621"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83484"
FT                   /protein_id="ADI83484.2"
FT                   /translation="MRQDDLKLLGKIVTTHGIRGQLKVASFSGEFDTILSLETVVLKGK
FT                   DGRMETFPVARATVHHDRVLLSLTPFTNINEVLHLIGCELYAHRDQFPPLEEGEYYWCD
FT                   LIGLQVVTAAGTVIGRLDSILPTESHDVYVVRGADREYLIPAVEDVVVQVDLEAGTMTV
FT                   SPPEGLLDL"
     MRQDDLKLLG KIVTTHGIRG QLKVASFSGE FDTILSLETV VLKGKDGRME TFPVARATVH        60
     HDRVLLSLTP FTNINEVLHL IGCELYAHRD QFPPLEEGEY YWCDLIGLQV VTAAGTVIGR       120
     LDSILPTESH DVYVVRGADR EYLIPAVEDV VVQVDLEAGT MTVSPPEGLL DL               172
//

If you have problems or comments...

PBIL Back to PBIL home page