(data stored in SCRATCH3701 zone)

EMBL: CP002031.RNK-1

CP002031.RNK-1       Location/Qualifiers
FT   CDS             complement(757546..757974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk-1"
FT                   /locus_tag="KN400_0711"
FT                   /product="RNA polymerase-binding protein Rnk"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83574"
FT                   /protein_id="ADI83574.2"
FT                   /translation="MKKKAEERSIYITEFDLTRLEELLDKIDTEGSRDSRHLQELEDEL
FT                   LRAEVVEPQQIPADVVTMNSRVALKDLATGEEMVYELVFPSDARLEENRISILAPVGTA
FT                   LLGYRAGDTITWKVPGGTRKIKITKILYQPEAAGDFHR"
     MKKKAEERSI YITEFDLTRL EELLDKIDTE GSRDSRHLQE LEDELLRAEV VEPQQIPADV        60
     VTMNSRVALK DLATGEEMVY ELVFPSDARL EENRISILAP VGTALLGYRA GDTITWKVPG       120
     GTRKIKITKI LYQPEAAGDF HR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page