(data stored in SCRATCH3701 zone)

EMBL: CP002031.RPLI

CP002031.RPLI        Location/Qualifiers
FT   CDS             681960..682406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="KN400_0644"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83507"
FT                   /protein_id="ADI83507.1"
FT                   /translation="MKVILKENVENLGHIGDIVKVAPGYARNYLIPRNFAIEATEKNAK
FT                   ALEHAKRQLEYKRNKVLEQARLLVAKIEGLSLSISHQAGEEGKLFGSVTNMELAELLKA
FT                   QGVEIDRKKIVLAEPIKHVGEFTAVVKVHPEVAANLKVVVTKAE"
     MKVILKENVE NLGHIGDIVK VAPGYARNYL IPRNFAIEAT EKNAKALEHA KRQLEYKRNK        60
     VLEQARLLVA KIEGLSLSIS HQAGEEGKLF GSVTNMELAE LLKAQGVEID RKKIVLAEPI       120
     KHVGEFTAVV KVHPEVAANL KVVVTKAE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page