(data stored in SCRATCH3701 zone)

EMBL: CP002031.RPLS

CP002031.RPLS        Location/Qualifiers
FT   CDS             659183..659539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="KN400_0624"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83487"
FT                   /protein_id="ADI83487.1"
FT                   /translation="MNKIDAIELEQMKKNIPPFKPGDTLKVHVKIVEGDKSRIQAFQGV
FT                   CISRQNGGIRESFTVRKISNNIGVERVFPLHSPTVDAIEVITRGHVRRAKLYYLRKLRG
FT                   KAARIREKKYVAAQ"
     MNKIDAIELE QMKKNIPPFK PGDTLKVHVK IVEGDKSRIQ AFQGVCISRQ NGGIRESFTV        60
     RKISNNIGVE RVFPLHSPTV DAIEVITRGH VRRAKLYYLR KLRGKAARIR EKKYVAAQ         118
//

If you have problems or comments...

PBIL Back to PBIL home page