(data stored in SCRATCH3701 zone)

EMBL: CP002031.RPSF

CP002031.RPSF        Location/Qualifiers
FT   CDS             680297..680650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="KN400_0641"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83504"
FT                   /protein_id="ADI83504.1"
FT                   /translation="MVRMYETIVIVQPELGDDELKGLTAKVTDIIGSFKGVLHRLEDWG
FT                   VRKLAYPVKKSVRGRYYYVRFDGDAPLIAELERRLRLDDKVLRYQSVKLEKEAAAPAPK
FT                   AAPVESAPAVEAE"
     MVRMYETIVI VQPELGDDEL KGLTAKVTDI IGSFKGVLHR LEDWGVRKLA YPVKKSVRGR        60
     YYYVRFDGDA PLIAELERRL RLDDKVLRYQ SVKLEKEAAA PAPKAAPVES APAVEAE          117
//

If you have problems or comments...

PBIL Back to PBIL home page