(data stored in SCRATCH3701 zone)

EMBL: CP002031.THIE/THID

CP002031.THIE/THID   Location/Qualifiers
FT   CDS             complement(618119..619591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE/thiD"
FT                   /locus_tag="KN400_0583"
FT                   /product="4-amino-5-hydroxymethyl-2-methylpyrimidine-phosphate
FT                   kinase and thiamin monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83446"
FT                   /protein_id="ADI83446.1"
FT                   /translation="MASNGHTLRLVINRDKHDSVIRGLYLVTDHDDNLIPRVEAAIDGG
FT                   ARVVQYRNKNQDRESRLALGLELRELCRRRSIPFIVNDDLEMAVSLKADGLHLGQGDGD
FT                   PREARRVLGPGKIIGVSTHTLSEALEAQAAGVDYIGLGAMFPSRSKEVEHVAGSELLAA
FT                   IRSSISIPIVAIGGITRDNGASVIDAGADAVAVISAVLSHPDPALAATEIALLFNRRAP
FT                   FPRGSVLTVAGSDSGGGAGIQADLKTVTLLGSYGSSVLTALTAQNTRGVSGIHGVPPAF
FT                   VADQLDAVFSDIPVDVVKTGMLFSAETIVAIAAKLTEYRRRMVVVDPVMVAKGGANLID
FT                   RGAVSVLKERLFPLAYLVTPNIPEAERLTGANISDEESMREAARRLHRLGARNVLLKGG
FT                   HLLAGDSVDILFDGAAFHRFVSPRILSKNTHGTGCTFASAIATYLAQGDPLREAIARAK
FT                   RYITAAIRLAQPLGRGHGPVNHILAAEDVRDR"
     MASNGHTLRL VINRDKHDSV IRGLYLVTDH DDNLIPRVEA AIDGGARVVQ YRNKNQDRES        60
     RLALGLELRE LCRRRSIPFI VNDDLEMAVS LKADGLHLGQ GDGDPREARR VLGPGKIIGV       120
     STHTLSEALE AQAAGVDYIG LGAMFPSRSK EVEHVAGSEL LAAIRSSISI PIVAIGGITR       180
     DNGASVIDAG ADAVAVISAV LSHPDPALAA TEIALLFNRR APFPRGSVLT VAGSDSGGGA       240
     GIQADLKTVT LLGSYGSSVL TALTAQNTRG VSGIHGVPPA FVADQLDAVF SDIPVDVVKT       300
     GMLFSAETIV AIAAKLTEYR RRMVVVDPVM VAKGGANLID RGAVSVLKER LFPLAYLVTP       360
     NIPEAERLTG ANISDEESMR EAARRLHRLG ARNVLLKGGH LLAGDSVDIL FDGAAFHRFV       420
     SPRILSKNTH GTGCTFASAI ATYLAQGDPL REAIARAKRY ITAAIRLAQP LGRGHGPVNH       480
     ILAAEDVRDR                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page