(data stored in SCRATCH3701 zone)

EMBL: CP002031.TSSE

CP002031.TSSE        Location/Qualifiers
FT   CDS             424925..425332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssE"
FT                   /locus_tag="KN400_0399"
FT                   /product="type VI secretion system needle hub protein TssE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83262"
FT                   /protein_id="ADI83262.1"
FT                   /translation="MREERLLERIRSLERDPSRRGGTDRGRLVDSILAHVRRIINTRRG
FT                   SVPIAPDFGIPDMLDVLQSYPDSVREIERSIRAAIQGFEPRLADVRVAFVPQEDDVLAL
FT                   RFAISARLGSDGGAVCFETLVDTDGKVTVRR"
     MREERLLERI RSLERDPSRR GGTDRGRLVD SILAHVRRII NTRRGSVPIA PDFGIPDMLD        60
     VLQSYPDSVR EIERSIRAAI QGFEPRLADV RVAFVPQEDD VLALRFAISA RLGSDGGAVC       120
     FETLVDTDGK VTVRR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page