(data stored in SCRATCH3701 zone)

EMBL: CP002031.TSSF

CP002031.TSSF        Location/Qualifiers
FT   CDS             425361..427094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssF"
FT                   /locus_tag="KN400_0400"
FT                   /product="type VI secretion system protein TssF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83263"
FT                   /protein_id="ADI83263.1"
FT                   /translation="MITRHFQDELARLKELGAEFSVTHPALAPMLGGPSTDPDVERLLE
FT                   GVAFQTALLRQKLDDDFPEVVHDLVRLVAPHYLRPVPATTIVAFEPKPSLTRSRLIPAG
FT                   TELASIPVEGTRCLFRTTSPVELHPLELLEATFAQPAGSAPVVTLSLSLTGLSLDHWEP
FT                   RSLRFFLAGDHAPAAELFLILSRHLKRIVITPEERGASASLPAACLQPVGLNDDEHLIP
FT                   WPSHAFPGYRLLQEYFAAPQRFLFLELTGWERWTTRGSGSRFTITFELGELTIPPPPVR
FT                   RDSFVLFASPAVNLFSHDAEPILLDHRVGRYPVRPAGLEPGHGQVYSVDRVTGIVRGAA
FT                   TERIYHPFEQFRDGADAQPTFHTAVSASPVRAGFDVHLAVAYPQGEGLPETETLSIALT
FT                   CSNGRLPENLWLGDLCEPTSSSPESATFHNITPLTPTLLPPLGKNLLWRLVSHLSLNRL
FT                   SLASADNLRTLLALYLFEEGGDRGDLAANRKRLDGIEAVIAKPAGRLVGGHLLRGSEIV
FT                   LTLRGDHFASPGDLFLFGAVLDRFLGGYASLNSFTRLTVRESVRGEVYSWAPRLGHRQL
FT                   L"
     MITRHFQDEL ARLKELGAEF SVTHPALAPM LGGPSTDPDV ERLLEGVAFQ TALLRQKLDD        60
     DFPEVVHDLV RLVAPHYLRP VPATTIVAFE PKPSLTRSRL IPAGTELASI PVEGTRCLFR       120
     TTSPVELHPL ELLEATFAQP AGSAPVVTLS LSLTGLSLDH WEPRSLRFFL AGDHAPAAEL       180
     FLILSRHLKR IVITPEERGA SASLPAACLQ PVGLNDDEHL IPWPSHAFPG YRLLQEYFAA       240
     PQRFLFLELT GWERWTTRGS GSRFTITFEL GELTIPPPPV RRDSFVLFAS PAVNLFSHDA       300
     EPILLDHRVG RYPVRPAGLE PGHGQVYSVD RVTGIVRGAA TERIYHPFEQ FRDGADAQPT       360
     FHTAVSASPV RAGFDVHLAV AYPQGEGLPE TETLSIALTC SNGRLPENLW LGDLCEPTSS       420
     SPESATFHNI TPLTPTLLPP LGKNLLWRLV SHLSLNRLSL ASADNLRTLL ALYLFEEGGD       480
     RGDLAANRKR LDGIEAVIAK PAGRLVGGHL LRGSEIVLTL RGDHFASPGD LFLFGAVLDR       540
     FLGGYASLNS FTRLTVRESV RGEVYSWAPR LGHRQLL                                577
//

If you have problems or comments...

PBIL Back to PBIL home page