(data stored in SCRATCH3701 zone)

EMBL: CP002031.TSSG

CP002031.TSSG        Location/Qualifiers
FT   CDS             427058..428050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssG"
FT                   /locus_tag="KN400_0401"
FT                   /product="type VI secretion system protein TssG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83264"
FT                   /protein_id="ADI83264.1"
FT                   /translation="MGSPPWSPPASLETQLFERGHEFSFAQAVRLLRLLAAAQGREGAC
FT                   PCGVRVRPELSLSFPVADVARIERQSDGYRITARFLGLYGPSSPLPTFYTEELIDEERE
FT                   DGSASRDFLDVLSHRIFDLWVAGDAKYRLFNRVVEDGSGDDLERLFCLAGLDLAQGQTV
FT                   LPESGRWLRYVGLLGQVPRSALGLRTMVADALGVPVEVIPCQHRQVSIPPGQRLAVGIA
FT                   ASSLGIDTVVGTNLDDRLGMFRLCLGPLSREQFADLLPGAPGRSTLDLIVELYLDAPLA
FT                   WDVELTLAPGETPEARLGACRGARVGWDTWLGVAAGESLPCVVFPGHFP"
     MGSPPWSPPA SLETQLFERG HEFSFAQAVR LLRLLAAAQG REGACPCGVR VRPELSLSFP        60
     VADVARIERQ SDGYRITARF LGLYGPSSPL PTFYTEELID EEREDGSASR DFLDVLSHRI       120
     FDLWVAGDAK YRLFNRVVED GSGDDLERLF CLAGLDLAQG QTVLPESGRW LRYVGLLGQV       180
     PRSALGLRTM VADALGVPVE VIPCQHRQVS IPPGQRLAVG IAASSLGIDT VVGTNLDDRL       240
     GMFRLCLGPL SREQFADLLP GAPGRSTLDL IVELYLDAPL AWDVELTLAP GETPEARLGA       300
     CRGARVGWDT WLGVAAGESL PCVVFPGHFP                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page