(data stored in SCRATCH3701 zone)

EMBL: CP002031.YCIH

CP002031.YCIH        Location/Qualifiers
FT   CDS             complement(709670..710035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciH"
FT                   /locus_tag="KN400_0665"
FT                   /product="translation initation factor-related protein
FT                   YciH"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83528"
FT                   /protein_id="ADI83528.1"
FT                   /translation="MKGKSSSGATLVWSSEHGRICSGCGKPVASCSCREKGAAPAGDGI
FT                   VRVRRETKGRGGKTVTVITGVPLNEAGVRELAGELKRRCGTGGTVKEGVVEIQGDHADL
FT                   LVAELTRRGFIVKRAGG"
     MKGKSSSGAT LVWSSEHGRI CSGCGKPVAS CSCREKGAAP AGDGIVRVRR ETKGRGGKTV        60
     TVITGVPLNE AGVRELAGEL KRRCGTGGTV KEGVVEIQGD HADLLVAELT RRGFIVKRAG       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page