(data stored in SCRATCH3701 zone)

EMBL: CP002031.YFIO

CP002031.YFIO        Location/Qualifiers
FT   CDS             522361..523125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiO"
FT                   /locus_tag="KN400_0490"
FT                   /product="outer membrane protein assembly lipoprotein YfiO,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83353"
FT                   /protein_id="ADI83353.1"
FT                   /translation="MNVSRLCSLYPTLLIPLLFVAGCGLFASSTAPVSRSPESMAREAE
FT                   EFQSSRRFEDAIAQWRKVKESYISPELITLAEIKIADAQFDSGNYIEAAASYEEFRKLH
FT                   PNHEKSAYALYRQGLSYFNQIHGFDTDQTPVSNTVTIFESFLRLYPQSEYAEEVRNKLD
FT                   AARQNQVQYEIYVGQFYYRTEKYTSAIKRLEDALKRYPRSPLHDETLYYLGKAYIKAGD
FT                   KAGGREAFQRLFNEFRTSKYVDEARSFLDKNF"
     MNVSRLCSLY PTLLIPLLFV AGCGLFASST APVSRSPESM AREAEEFQSS RRFEDAIAQW        60
     RKVKESYISP ELITLAEIKI ADAQFDSGNY IEAAASYEEF RKLHPNHEKS AYALYRQGLS       120
     YFNQIHGFDT DQTPVSNTVT IFESFLRLYP QSEYAEEVRN KLDAARQNQV QYEIYVGQFY       180
     YRTEKYTSAI KRLEDALKRY PRSPLHDETL YYLGKAYIKA GDKAGGREAF QRLFNEFRTS       240
     KYVDEARSFL DKNF                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page