(data stored in SCRATCH3701 zone)

EMBL: CP002031.YHCC-2

CP002031.YHCC-2      Location/Qualifiers
FT   CDS             complement(598684..599643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcC-2"
FT                   /locus_tag="KN400_0564"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83427"
FT                   /protein_id="ADI83427.1"
FT                   /translation="MSDLFIHPELRFHSYGTWLRRRFGCNVSKVNVDGGFTCPNRDGSR
FT                   GTGGCIYCDNASFSPGGTVPDKSIELQMAEGMAYHRQRLGSEKFIIYFQKFTNTYAPAA
FT                   RLRDLYTRALSHPDVVGISVGTRPDALADEALELLADLAQEHYVCIELGLQSMDDAILE
FT                   RINRGHTLDEYLRTVDRIAGRGIALCTHLIYGFPGETREGFLKTAHLLAGLPVDSVKLH
FT                   QLHAVKGTRLAELYHRREFVPITLAEYVTTACDFLELLPPRIAVQRLYGSAPLAIRVAP
FT                   TWNLKNNQMWYAIVNELRRRGTWQGCRLDREHCRVGNL"
     MSDLFIHPEL RFHSYGTWLR RRFGCNVSKV NVDGGFTCPN RDGSRGTGGC IYCDNASFSP        60
     GGTVPDKSIE LQMAEGMAYH RQRLGSEKFI IYFQKFTNTY APAARLRDLY TRALSHPDVV       120
     GISVGTRPDA LADEALELLA DLAQEHYVCI ELGLQSMDDA ILERINRGHT LDEYLRTVDR       180
     IAGRGIALCT HLIYGFPGET REGFLKTAHL LAGLPVDSVK LHQLHAVKGT RLAELYHRRE       240
     FVPITLAEYV TTACDFLELL PPRIAVQRLY GSAPLAIRVA PTWNLKNNQM WYAIVNELRR       300
     RGTWQGCRLD REHCRVGNL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page