(data stored in ACNUC7421 zone)

EMBL: CP002047.CYP7

CP002047.CYP7        Location/Qualifiers
FT   CDS             446332..447555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp7"
FT                   /locus_tag="SBI_00379"
FT                   /product="cytochrome P450 family protein"
FT                   /note="COG2124 Cytochrome P450, CYP147F2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03500"
FT                   /db_xref="GOA:D7BYH2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH2"
FT                   /protein_id="ADI03500.1"
FT                   /translation="MTLGSMSARINDYANRADPYPLFAELRKQPVIREDDGTYLVSTYY
FT                   EVKSLANDPRLSNDTRNRAPGCARTGGSEENTGLPPSFIFTDPPEHDRLRGTANRPFGP
FT                   PHSPRFLHDLQADLAKVVTELLDAFEGKDQVDIVEDFSYPLPVTAICKVLGVPREDEPR
FT                   FHGWADALAAGVDPHPGENGQERADTARQEMGSYLADLIDASRRHPRPGILSALAPHTG
FT                   PGGRMTPKDLVATAVLLLVAGHETTVNLITNTTLTLLRHPDVLRRFQHDQDLATPLIEE
FT                   VLRYEPPVQFVPWTTALADIDIADTTIPKGSPVWLMLAAANRDPRRFEDPDRFMPERKD
FT                   NEHLGFYTGIHYCFGAPLARIEAHLALPELFRRVKDFRLLEDPPPYRANAVLRGPRHLP
FT                   VAIEGVTA"
     MTLGSMSARI NDYANRADPY PLFAELRKQP VIREDDGTYL VSTYYEVKSL ANDPRLSNDT        60
     RNRAPGCART GGSEENTGLP PSFIFTDPPE HDRLRGTANR PFGPPHSPRF LHDLQADLAK       120
     VVTELLDAFE GKDQVDIVED FSYPLPVTAI CKVLGVPRED EPRFHGWADA LAAGVDPHPG       180
     ENGQERADTA RQEMGSYLAD LIDASRRHPR PGILSALAPH TGPGGRMTPK DLVATAVLLL       240
     VAGHETTVNL ITNTTLTLLR HPDVLRRFQH DQDLATPLIE EVLRYEPPVQ FVPWTTALAD       300
     IDIADTTIPK GSPVWLMLAA ANRDPRRFED PDRFMPERKD NEHLGFYTGI HYCFGAPLAR       360
     IEAHLALPEL FRRVKDFRLL EDPPPYRANA VLRGPRHLPV AIEGVTA                     407
//

If you have problems or comments...

PBIL Back to PBIL home page