(data stored in ACNUC7421 zone)

EMBL: CP002047.FADE1

CP002047.FADE1       Location/Qualifiers
FT   CDS             196668..197195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="SBI_00178"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03299"
FT                   /db_xref="GOA:D7BUV8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV8"
FT                   /protein_id="ADI03299.1"
FT                   /translation="MLQEEAARALVTLGTVRTQLDVVLPYFLAYADTEQRERWYPGLAS
FT                   GELLTAIAMTEPGTGSDIEGIRTTAVRDGDAYVLNGAKTFITGGLLADLVTVVARTSTD
FT                   PGDRRAGLTLMEDGMPGSAGPYPRRCLQLCGGYRYMLEYPIARLYADARITHFHAGTSE
FT                   VMKVIIAKSLGL"
     MLQEEAARAL VTLGTVRTQL DVVLPYFLAY ADTEQRERWY PGLASGELLT AIAMTEPGTG        60
     SDIEGIRTTA VRDGDAYVLN GAKTFITGGL LADLVTVVAR TSTDPGDRRA GLTLMEDGMP       120
     GSAGPYPRRC LQLCGGYRYM LEYPIARLYA DARITHFHAG TSEVMKVIIA KSLGL            175
//

If you have problems or comments...

PBIL Back to PBIL home page