(data stored in ACNUC7421 zone)

EMBL: CP002047.GND1

CP002047.GND1        Location/Qualifiers
FT   CDS             415944..416978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd1"
FT                   /locus_tag="SBI_00352"
FT                   /product="6-phosphogluconate dehydrogenase-like protein"
FT                   /note="COG1023 Predicted 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03473"
FT                   /db_xref="GOA:D7BYE5"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE5"
FT                   /protein_id="ADI03473.1"
FT                   /translation="MATDTPMQLGMIGLGRMGANLVRRLMRDGHRCVVYDLDESAVREL
FT                   EGEGAVAARSLGDLVAKLERPRAAWLMLPAAVVQPTLDQLAELLDPDDAVIDGGNSYYR
FT                   DDITRAAQLAPRRIHYLDCGTSGGVWGLDRGYCLMIGGEREPVARLDPIFRTIAPGTGS
FT                   AEPTPSRQADGTAPQGYLHCGPSGAGHFVKMVHNGVEYGMMASIAEGLSIIEHADAGLR
FT                   KRTADAETTPLREPEAYQYEIDVGEVAEVWRRGSVVGSWLVDLTADALARSPHLEDFAG
FT                   HVSDSGEGRWTVRAAIDEGVPTPVIATALTDRFESRGLGEFGDRVLSAMRSEFGGHAEK
FT                   RSRP"
     MATDTPMQLG MIGLGRMGAN LVRRLMRDGH RCVVYDLDES AVRELEGEGA VAARSLGDLV        60
     AKLERPRAAW LMLPAAVVQP TLDQLAELLD PDDAVIDGGN SYYRDDITRA AQLAPRRIHY       120
     LDCGTSGGVW GLDRGYCLMI GGEREPVARL DPIFRTIAPG TGSAEPTPSR QADGTAPQGY       180
     LHCGPSGAGH FVKMVHNGVE YGMMASIAEG LSIIEHADAG LRKRTADAET TPLREPEAYQ       240
     YEIDVGEVAE VWRRGSVVGS WLVDLTADAL ARSPHLEDFA GHVSDSGEGR WTVRAAIDEG       300
     VPTPVIATAL TDRFESRGLG EFGDRVLSAM RSEFGGHAEK RSRP                        344
//

If you have problems or comments...

PBIL Back to PBIL home page