(data stored in ACNUC7421 zone)

EMBL: CP002047.ILVB1

CP002047.ILVB1       Location/Qualifiers
FT   CDS             464817..466481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB1"
FT                   /locus_tag="SBI_00397"
FT                   /product="putative acetolactate synthase, large subunit"
FT                   /note="COG0028 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03518"
FT                   /db_xref="GOA:D7BYJ0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ0"
FT                   /protein_id="ADI03518.1"
FT                   /translation="MVNVEPPERPLSAGHLIVAQLEREGVRRIYGVPGESFLDVLDGLH
FT                   DSPMSTVVTRHEGGAGFMALAEGRLTGRPGVAIVTRGPGAANAFIAVHTAYQDATPMVL
FT                   FVGLIPVPDRGREAFQEFDLSGWFGSTAKKVVMLDDPTAAARVVSEAVHAARSGRPGPV
FT                   VIGLPEDILTRPAAPSRTVQPLAVARPRAAEAELKELVGRFERARRPLVVVGGEGWTTQ
FT                   SGRELIRWATERSVPVLADFRAYDAVPHDLDGSGAYAGSLGYGRSDHAAQLLDDADLTV
FT                   FLGAPRGDVLSDGYTRGLDSETVLVLPGDAPGHCGRIDQFITAHAPSFVLDLVTAPAAL
FT                   RADVAWFRAARAAHARFRTPAPATDSVADDAFVDLTAVMGVLRQELAPDAVITYGAGNH
FT                   ALWPARYLPHQAPASLIAPRNGAMGMGIPAAVAASLAFPGREVVSVAGDGCFLMNGQEL
FT                   ATAVGHGAVFVALVVDNGCYATIREHQEDAYPDRPSGTQLTNPDFAAWARSYGAYGETV
FT                   AATRDFRDAFRRARASGLPAVLHLIQDPAVRAPATVG"
     MVNVEPPERP LSAGHLIVAQ LEREGVRRIY GVPGESFLDV LDGLHDSPMS TVVTRHEGGA        60
     GFMALAEGRL TGRPGVAIVT RGPGAANAFI AVHTAYQDAT PMVLFVGLIP VPDRGREAFQ       120
     EFDLSGWFGS TAKKVVMLDD PTAAARVVSE AVHAARSGRP GPVVIGLPED ILTRPAAPSR       180
     TVQPLAVARP RAAEAELKEL VGRFERARRP LVVVGGEGWT TQSGRELIRW ATERSVPVLA       240
     DFRAYDAVPH DLDGSGAYAG SLGYGRSDHA AQLLDDADLT VFLGAPRGDV LSDGYTRGLD       300
     SETVLVLPGD APGHCGRIDQ FITAHAPSFV LDLVTAPAAL RADVAWFRAA RAAHARFRTP       360
     APATDSVADD AFVDLTAVMG VLRQELAPDA VITYGAGNHA LWPARYLPHQ APASLIAPRN       420
     GAMGMGIPAA VAASLAFPGR EVVSVAGDGC FLMNGQELAT AVGHGAVFVA LVVDNGCYAT       480
     IREHQEDAYP DRPSGTQLTN PDFAAWARSY GAYGETVAAT RDFRDAFRRA RASGLPAVLH       540
     LIQDPAVRAP ATVG                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page