(data stored in ACNUC7421 zone)

EMBL: CP002047.PE10

CP002047.PE10        Location/Qualifiers
FT   CDS             complement(8657..8944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00010"
FT                   /product="hypothetical protein"
FT                   /note="COG0804 Urea amidohydrolase (urease) alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03131"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV4"
FT                   /protein_id="ADI03131.1"
FT                   /translation="MSVWSLETSGTSTEGLFHVRGPVPDDVAGADRRTMSPREVAADLA
FT                   QQAMVAGDQARMDALAEVADQLLANSRAEVGEDCDGQLTRARGGGVTAAI"
     MSVWSLETSG TSTEGLFHVR GPVPDDVAGA DRRTMSPREV AADLAQQAMV AGDQARMDAL        60
     AEVADQLLAN SRAEVGEDCD GQLTRARGGG VTAAI                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page