(data stored in ACNUC7421 zone)

EMBL: CP002047.PE101

CP002047.PE101       Location/Qualifiers
FT   CDS             complement(91902..92648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00101"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03222"
FT                   /db_xref="GOA:D7BUN1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN1"
FT                   /protein_id="ADI03222.1"
FT                   /translation="MGLETARLLARDGAAVVLLGRRQQTLDAVAATIRAEGGTALALAT
FT                   DITRADDVTRVLDRVRAELGPVDVLVNNAGSASSVLNPQWLPHDEWRQVLDVNLTAVFQ
FT                   LTQAVLPDMLGRGTGTIVTVSSLAAVNPNLLGGAAYGAAKAGVRNFMTFLHNTFRNQGL
FT                   RAITVLPGEADTPILDNRARPPAPEERADMVRPEDVAEAIRLAVALPQRVVLQEIVVAP
FT                   TRQRDTSADLEISRWAGAPADAAPQA"
     MGLETARLLA RDGAAVVLLG RRQQTLDAVA ATIRAEGGTA LALATDITRA DDVTRVLDRV        60
     RAELGPVDVL VNNAGSASSV LNPQWLPHDE WRQVLDVNLT AVFQLTQAVL PDMLGRGTGT       120
     IVTVSSLAAV NPNLLGGAAY GAAKAGVRNF MTFLHNTFRN QGLRAITVLP GEADTPILDN       180
     RARPPAPEER ADMVRPEDVA EAIRLAVALP QRVVLQEIVV APTRQRDTSA DLEISRWAGA       240
     PADAAPQA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page