(data stored in ACNUC7421 zone)

EMBL: CP002047.PE102

CP002047.PE102       Location/Qualifiers
FT   CDS             complement(92753..93757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00102"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /note="COG1984 Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03223"
FT                   /db_xref="GOA:D7BUN2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN2"
FT                   /protein_id="ADI03223.1"
FT                   /translation="MKTVALDITSTGWVTTFQDLGRRDTERRGVPTGGAADQHSAAVAN
FT                   LLVGNPRGAALIENLGGELAFVPDADVLLAVTGAPARVTVAGSPADGWSPLVVPAGHEV
FT                   RVRGDMDQGTRTYLAVNGTPRTKTLLGSAAPDARMGFGQAVTRGSRVLLETEFRGFRRR
FT                   LFEPPLFRLPVPVPRFDAGPWDIDVVAGHGVQAIAGIREVIEEATYVVTPRSNHVGLRL
FT                   DGPVLHPDTDTEIVSHGVPIGALQIPHADELIVLGRYRSLTAGYPIVGVASRASLPLLG
FT                   QAGPGRRLRFRWIDREASLRRFARREAEVRALGYAAAEAFGALGFMEPLRHMN"
     MKTVALDITS TGWVTTFQDL GRRDTERRGV PTGGAADQHS AAVANLLVGN PRGAALIENL        60
     GGELAFVPDA DVLLAVTGAP ARVTVAGSPA DGWSPLVVPA GHEVRVRGDM DQGTRTYLAV       120
     NGTPRTKTLL GSAAPDARMG FGQAVTRGSR VLLETEFRGF RRRLFEPPLF RLPVPVPRFD       180
     AGPWDIDVVA GHGVQAIAGI REVIEEATYV VTPRSNHVGL RLDGPVLHPD TDTEIVSHGV       240
     PIGALQIPHA DELIVLGRYR SLTAGYPIVG VASRASLPLL GQAGPGRRLR FRWIDREASL       300
     RRFARREAEV RALGYAAAEA FGALGFMEPL RHMN                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page