(data stored in ACNUC7421 zone)

EMBL: CP002047.PE108

CP002047.PE108       Location/Qualifiers
FT   CDS             complement(99257..100210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00108"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03229"
FT                   /db_xref="GOA:D7BUN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN8"
FT                   /protein_id="ADI03229.1"
FT                   /translation="MLLRQLEYLVALARARHFAKAAQACFVSQPALSEGIRKLEEELGI
FT                   PLVQRGRRFDGFTPEGERVVLWAQRILADRDAMRGEIQALRAGLSGRLRIGTVPTASTA
FT                   VALLTQPFCAANPLATVQVFADLQAEDIVNRLRTYELDAAVTYHSSVAAHDFKFVPLYR
FT                   ERHVLLTQRSAPDSGAAEISWEEAAQYPLCLLHPMMQGRQVLDAVFETVGVSVTPRVET
FT                   DSIASLFAQVRAGQWASIVPHAWLHVFGVPGGMRAVPLVRPVRTERIGLVLPAREPVSV
FT                   IGQALIDVVERAGIAATLERLPHQAPGDDTPFGVQG"
     MLLRQLEYLV ALARARHFAK AAQACFVSQP ALSEGIRKLE EELGIPLVQR GRRFDGFTPE        60
     GERVVLWAQR ILADRDAMRG EIQALRAGLS GRLRIGTVPT ASTAVALLTQ PFCAANPLAT       120
     VQVFADLQAE DIVNRLRTYE LDAAVTYHSS VAAHDFKFVP LYRERHVLLT QRSAPDSGAA       180
     EISWEEAAQY PLCLLHPMMQ GRQVLDAVFE TVGVSVTPRV ETDSIASLFA QVRAGQWASI       240
     VPHAWLHVFG VPGGMRAVPL VRPVRTERIG LVLPAREPVS VIGQALIDVV ERAGIAATLE       300
     RLPHQAPGDD TPFGVQG                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page