(data stored in ACNUC7421 zone)

EMBL: CP002047.PE109

CP002047.PE109       Location/Qualifiers
FT   CDS             100397..102694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00109"
FT                   /product="oxidoreductase alpha subunit"
FT                   /note="COG0243 Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03230"
FT                   /db_xref="GOA:D7BUN9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN9"
FT                   /protein_id="ADI03230.1"
FT                   /translation="MRDFDEPDQDELSVTAPKTWATGAPAVVHALQYALGQTSPKRTAL
FT                   TLLNINQAKGFDCPGCAWPEPAPGKRHRNEYCENGAKHISDEATSRRVTAEFFRQHSVD
FT                   ELSRKSDYWLNQQGRLTEPMVLREGATHYEPIGWDEALDLLADELRALDHPDEALFYTS
FT                   GRLANEPAFLLQLFARAFGTNNLPDCSNMCHESSGSALNETLGIGKGSVSLDDLYNADL
FT                   IFVVGQNPGTNHPRMLSALEETKRRGGHVVAVNPLPEAGLLRFKHPQKARGIIGRGTDI
FT                   ADQFLQIRPGGDLALFQALNLLLLEAEDKEPGTVLDREFIESHTTGYDAFAEHIRETSW
FT                   DAVLEATGLSRDEIEQVHERVLACRSVIVCWAMGLTQHKHGVPTIREVVNFLLLRGNIG
FT                   RPGAGVCPVRGHSNVQGDRTMGIWERMPQPFLDRLGREFRFTAPTKHGLDSVDSIRAML
FT                   DGRAKLFVGVAGNFVRATPDSEVTERALRNCRLTAHISTKLNRSHAVCGRTALILPTLG
FT                   RSDRDVQAGGEQFMTVEDSMSEVHATRGRLAPASAHLLSEVSIISRLARKVLGSEPDIP
FT                   WADFEADYDLVRDRIARVVDGFENFNERVRRPGGFHLPNPVNEKVFRTPAGKAVFTVND
FT                   FTMLQAPEGHLVLQTLRSHDQWNTIPYAMDDRYRGIKGGRRVVLVNRADLADLGLDDGS
FT                   LVDLVSVWTDGSERRADGFRVVAYPTPRGSAAAYYPETNVLVPLDSVADISNTPTSKSV
FT                   IVRLERAAGATR"
     MRDFDEPDQD ELSVTAPKTW ATGAPAVVHA LQYALGQTSP KRTALTLLNI NQAKGFDCPG        60
     CAWPEPAPGK RHRNEYCENG AKHISDEATS RRVTAEFFRQ HSVDELSRKS DYWLNQQGRL       120
     TEPMVLREGA THYEPIGWDE ALDLLADELR ALDHPDEALF YTSGRLANEP AFLLQLFARA       180
     FGTNNLPDCS NMCHESSGSA LNETLGIGKG SVSLDDLYNA DLIFVVGQNP GTNHPRMLSA       240
     LEETKRRGGH VVAVNPLPEA GLLRFKHPQK ARGIIGRGTD IADQFLQIRP GGDLALFQAL       300
     NLLLLEAEDK EPGTVLDREF IESHTTGYDA FAEHIRETSW DAVLEATGLS RDEIEQVHER       360
     VLACRSVIVC WAMGLTQHKH GVPTIREVVN FLLLRGNIGR PGAGVCPVRG HSNVQGDRTM       420
     GIWERMPQPF LDRLGREFRF TAPTKHGLDS VDSIRAMLDG RAKLFVGVAG NFVRATPDSE       480
     VTERALRNCR LTAHISTKLN RSHAVCGRTA LILPTLGRSD RDVQAGGEQF MTVEDSMSEV       540
     HATRGRLAPA SAHLLSEVSI ISRLARKVLG SEPDIPWADF EADYDLVRDR IARVVDGFEN       600
     FNERVRRPGG FHLPNPVNEK VFRTPAGKAV FTVNDFTMLQ APEGHLVLQT LRSHDQWNTI       660
     PYAMDDRYRG IKGGRRVVLV NRADLADLGL DDGSLVDLVS VWTDGSERRA DGFRVVAYPT       720
     PRGSAAAYYP ETNVLVPLDS VADISNTPTS KSVIVRLERA AGATR                       765
//

If you have problems or comments...

PBIL Back to PBIL home page