(data stored in ACNUC7421 zone)

EMBL: CP002047.PE11

CP002047.PE11        Location/Qualifiers
FT   CDS             9020..9520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03132"
FT                   /db_xref="GOA:D7BSV5"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV5"
FT                   /protein_id="ADI03132.1"
FT                   /translation="MLARMDWLPLISTLAGAAIGIVATLIADRSRWRREDAKEAVRLRL
FT                   EVYTQYTTVVKVLGETLRALREQEHPSDEERVVALREAFRESGIAVASERMWLIGPQPV
FT                   VKASNSVFHCLRSICDGYIDGTAVGSPEDHARWEARGKAAAKMRKLMREDLGVGPLLER
FT                   HSS"
     MLARMDWLPL ISTLAGAAIG IVATLIADRS RWRREDAKEA VRLRLEVYTQ YTTVVKVLGE        60
     TLRALREQEH PSDEERVVAL REAFRESGIA VASERMWLIG PQPVVKASNS VFHCLRSICD       120
     GYIDGTAVGS PEDHARWEAR GKAAAKMRKL MREDLGVGPL LERHSS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page