(data stored in ACNUC7421 zone)

EMBL: CP002047.PE112

CP002047.PE112       Location/Qualifiers
FT   CDS             complement(107554..107991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03233"
FT                   /db_xref="GOA:D7BUP2"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP2"
FT                   /protein_id="ADI03233.1"
FT                   /translation="MGVMLAIPGFGTAEARNHGAGLDLYLVLLFVISEALGLLTLGLVQ
FT                   PWGEAVPRWIPLLGGRRIRPLAAVVPAALGALASTGVVYYFFLSILFGGFPAGHTTPEE
FT                   VILTVCYLPLLAWGPLLGSVTYAYYRRRTSSQGQHTPTPSP"
     MGVMLAIPGF GTAEARNHGA GLDLYLVLLF VISEALGLLT LGLVQPWGEA VPRWIPLLGG        60
     RRIRPLAAVV PAALGALAST GVVYYFFLSI LFGGFPAGHT TPEEVILTVC YLPLLAWGPL       120
     LGSVTYAYYR RRTSSQGQHT PTPSP                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page