(data stored in ACNUC7421 zone)

EMBL: CP002047.PE113

CP002047.PE113       Location/Qualifiers
FT   CDS             complement(108317..108802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00113"
FT                   /product="hypothetical protein"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03234"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP3"
FT                   /protein_id="ADI03234.1"
FT                   /translation="MSVEADIPSLVGVHHLKLPVRDLARSEEWYGRTLGYRRAAEFVEQ
FT                   GVLIEVVLSHPAGGPDLALRLDPGRAEAAAGFDYFAIAVPDSAAIEALAARMEALGEPH
FT                   GGVWRGLRGWVLPRLHDPDGHEVRFYTVEEHTSHEPGEVMRMVDPLESAEQVRPAAP"
     MSVEADIPSL VGVHHLKLPV RDLARSEEWY GRTLGYRRAA EFVEQGVLIE VVLSHPAGGP        60
     DLALRLDPGR AEAAAGFDYF AIAVPDSAAI EALAARMEAL GEPHGGVWRG LRGWVLPRLH       120
     DPDGHEVRFY TVEEHTSHEP GEVMRMVDPL ESAEQVRPAA P                           161
//

If you have problems or comments...

PBIL Back to PBIL home page