(data stored in ACNUC7421 zone)

EMBL: CP002047.PE115

CP002047.PE115       Location/Qualifiers
FT   CDS             110670..111338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00115"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03236"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP5"
FT                   /protein_id="ADI03236.1"
FT                   /translation="MTITVRPGSTVMFTGDSITDCQRLESEDGLGFGYPLRVAGEWGLR
FT                   HPDRPVTWLNTAHAGDKVMDLEARWQTDVLDARPDVVSILVGVNDMGWHTLDPKGYVIP
FT                   AEEFEAGYDRLLTPLAEAGTKLILIEPFLLPIHGVVEAGAGVALIGEKERKEWRTDLDP
FT                   KIQVVRKLARKYGAHLLDADGMFAELAATTEPEYWAADGVHPTPAGHAALAAAWLRLVA
FT                   "
     MTITVRPGST VMFTGDSITD CQRLESEDGL GFGYPLRVAG EWGLRHPDRP VTWLNTAHAG        60
     DKVMDLEARW QTDVLDARPD VVSILVGVND MGWHTLDPKG YVIPAEEFEA GYDRLLTPLA       120
     EAGTKLILIE PFLLPIHGVV EAGAGVALIG EKERKEWRTD LDPKIQVVRK LARKYGAHLL       180
     DADGMFAELA ATTEPEYWAA DGVHPTPAGH AALAAAWLRL VA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page