(data stored in ACNUC7421 zone)

EMBL: CP002047.PE119

CP002047.PE119       Location/Qualifiers
FT   CDS             complement(112761..113186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00119"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03240"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP9"
FT                   /protein_id="ADI03240.1"
FT                   /translation="MFTQLQALPHRHVLTLPSAPAAVRSARETAEQALVEWGIGLRHPV
FT                   VGPALLILSELVTNSVRHAAELSPQLTVIYAASDVHLAFSVHDRHPYQPPLSELANSTG
FT                   TSGLATVMELTFALEGTAVIRGDTDGQGKSIWITLPL"
     MFTQLQALPH RHVLTLPSAP AAVRSARETA EQALVEWGIG LRHPVVGPAL LILSELVTNS        60
     VRHAAELSPQ LTVIYAASDV HLAFSVHDRH PYQPPLSELA NSTGTSGLAT VMELTFALEG       120
     TAVIRGDTDG QGKSIWITLP L                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page