(data stored in ACNUC7421 zone)

EMBL: CP002047.PE122

CP002047.PE122       Location/Qualifiers
FT   CDS             complement(115309..115866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00122"
FT                   /product="hypothetical protein"
FT                   /note="COG2353 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03243"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ2"
FT                   /protein_id="ADI03243.1"
FT                   /translation="MYGFGPSTGRLLIKTSRIGLGRKAGHDLTIEATRWSGKAVVVADD
FT                   PGKSSVTVEVETGSLIVREGAGGLKPLADADRAQIKRTLEGEALLHASRHPAIVFRSTG
FT                   ITGTLQSFEITGDLTIKGRTHPATVHGGSDGNGMVCGRGTVTQSTWGIKPYTAFLGTLK
FT                   LADEVRIEYAVTELERLPDPDG"
     MYGFGPSTGR LLIKTSRIGL GRKAGHDLTI EATRWSGKAV VVADDPGKSS VTVEVETGSL        60
     IVREGAGGLK PLADADRAQI KRTLEGEALL HASRHPAIVF RSTGITGTLQ SFEITGDLTI       120
     KGRTHPATVH GGSDGNGMVC GRGTVTQSTW GIKPYTAFLG TLKLADEVRI EYAVTELERL       180
     PDPDG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page