(data stored in ACNUC7421 zone)

EMBL: CP002047.PE124

CP002047.PE124       Location/Qualifiers
FT   CDS             116925..118352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03245"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ4"
FT                   /protein_id="ADI03245.1"
FT                   /translation="MTVLAALLDRSVEQIAKAAADVRRYDREAIRAASDVWDNNLFPLF
FT                   WAASTASADKRERRALTALEWMAGLGERRRGWMTEQAALAGYELEPLLPPAKPDTPGRD
FT                   YRGYVMTPACRLAQPTVDDLVPDYDLATAAVRHLRVERAGTRLTAFLQLVAPRRYAVDE
FT                   STPTQPALLNVALDGVTDAVFDLSATRGAALDPGAGGIEISLGTGGRLRAASGEYRLDD
FT                   HSWHLSAAGRRADAVTPPRTGRSDRLPPPPAGDLGADARAAAILLRHAMWELRSVRYAA
FT                   RADRVPVLDLCQAFAGAGEAILAAGSRRGAARREAAFRDVIRTWADRSGPALTRWIAAV
FT                   LKERADRPDIIEMPRSPERTPPSLTAGSPVFGTPSQAALVMAAWTAAHTDYRTERPAAA
FT                   VLQLALPPRPDEPPSAPWRLRTVSCTEPDAFRLHTDAFQGPGQLTQTGRPTAACSLDLH
FT                   HGAMVIAAPDGWSASVS"
     MTVLAALLDR SVEQIAKAAA DVRRYDREAI RAASDVWDNN LFPLFWAAST ASADKRERRA        60
     LTALEWMAGL GERRRGWMTE QAALAGYELE PLLPPAKPDT PGRDYRGYVM TPACRLAQPT       120
     VDDLVPDYDL ATAAVRHLRV ERAGTRLTAF LQLVAPRRYA VDESTPTQPA LLNVALDGVT       180
     DAVFDLSATR GAALDPGAGG IEISLGTGGR LRAASGEYRL DDHSWHLSAA GRRADAVTPP       240
     RTGRSDRLPP PPAGDLGADA RAAAILLRHA MWELRSVRYA ARADRVPVLD LCQAFAGAGE       300
     AILAAGSRRG AARREAAFRD VIRTWADRSG PALTRWIAAV LKERADRPDI IEMPRSPERT       360
     PPSLTAGSPV FGTPSQAALV MAAWTAAHTD YRTERPAAAV LQLALPPRPD EPPSAPWRLR       420
     TVSCTEPDAF RLHTDAFQGP GQLTQTGRPT AACSLDLHHG AMVIAAPDGW SASVS            475
//

If you have problems or comments...

PBIL Back to PBIL home page