(data stored in ACNUC7421 zone)

EMBL: CP002047.PE127

CP002047.PE127       Location/Qualifiers
FT   CDS             120072..121196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00127"
FT                   /product="putative DNA alkylation repair protein"
FT                   /note="COG4335 DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03248"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ7"
FT                   /protein_id="ADI03248.1"
FT                   /translation="MPTADELISPDSIRQLAAILQDTSPSTSRWQTVADSSTALGSLGL
FT                   SERARTVGDALLADSGPDYPRLAGAVRKALRREDLTGWMIWPVTEAVATAATTSGTTEH
FT                   FDDGLALLAQLTPRLTGEFALRTFLNTDLERTLATASTWTGSPDPAVRRLASEGTRPKL
FT                   PWARQVPELNRNPQATVPLLGELHTDTSADVRRSVANHLNDISRLDPHLAARTAAQWMD
FT                   HPAAPTTPALVRHAMRTLVKKGDPKALELVGFHGSRENLQVTGPLLTDTAIPAGGTLTF
FT                   TAHIKNVSDQPVSLAIDYVIHHKKANGKLAPKVFKLTKRNLTPGESADLTRRHSFRPIS
FT                   TRVYYPGTHAVQLQVNGQQHGLVEFDLGGTEARS"
     MPTADELISP DSIRQLAAIL QDTSPSTSRW QTVADSSTAL GSLGLSERAR TVGDALLADS        60
     GPDYPRLAGA VRKALRREDL TGWMIWPVTE AVATAATTSG TTEHFDDGLA LLAQLTPRLT       120
     GEFALRTFLN TDLERTLATA STWTGSPDPA VRRLASEGTR PKLPWARQVP ELNRNPQATV       180
     PLLGELHTDT SADVRRSVAN HLNDISRLDP HLAARTAAQW MDHPAAPTTP ALVRHAMRTL       240
     VKKGDPKALE LVGFHGSREN LQVTGPLLTD TAIPAGGTLT FTAHIKNVSD QPVSLAIDYV       300
     IHHKKANGKL APKVFKLTKR NLTPGESADL TRRHSFRPIS TRVYYPGTHA VQLQVNGQQH       360
     GLVEFDLGGT EARS                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page