(data stored in ACNUC7421 zone)

EMBL: CP002047.PE128

CP002047.PE128       Location/Qualifiers
FT   CDS             121493..123142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00128"
FT                   /product="putative integral membrane protein"
FT                   /note="COG1457 Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03249"
FT                   /db_xref="GOA:D7BUQ8"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ8"
FT                   /protein_id="ADI03249.1"
FT                   /translation="MSTTESPLKTTGTTRTTTDQAVKETLEDYTLRFAPRSYRRWTPMV
FT                   VATTALGGIAYMADFSIGAGIGLAHGTGNALVAIAVAAVVIFITGFPLAYYGARYNIDL
FT                   DLITRGSGFGYYGSVLTSVIFASFTFIFFALEGSIMAQGLKLGLGLPLWLGYLVSTLMV
FT                   IPLVIYGMKALSKLQVWTTPIWLLLMVGPLVYLVTTDPGTIDRFLAYAGTDGDGGVNTA
FT                   SVLLGAGVCLSLIAQIGEQIDYLRFMPPKTEANKRGWWTAVIMAGPGWVVLGALKQAIG
FT                   VFLAVYILAKVGPAAATEPIQQFRGAFDAMMPSWMVIPLAVALVVISQIKINVTNAYSG
FT                   SLAWTNSFTRVTKHYPGRMVFVLVNLGFALALMEADMFSFLNDILGFYSNCAIAWVVTV
FT                   ATDIGINKYLLKISPLQPEFRRGMLHAVNPVGVVAFVAASGLSIAMYFHLLGDTLQPYS
FT                   PVAAAVIAFVLTPLVAIITKGRYYLRRTDDGIAEPLLDPDGNPSSLTLDCHVCHQSYER
FT                   PDLTACATHDAVVCSLCLSTDKVGDHVLPGIA"
     MSTTESPLKT TGTTRTTTDQ AVKETLEDYT LRFAPRSYRR WTPMVVATTA LGGIAYMADF        60
     SIGAGIGLAH GTGNALVAIA VAAVVIFITG FPLAYYGARY NIDLDLITRG SGFGYYGSVL       120
     TSVIFASFTF IFFALEGSIM AQGLKLGLGL PLWLGYLVST LMVIPLVIYG MKALSKLQVW       180
     TTPIWLLLMV GPLVYLVTTD PGTIDRFLAY AGTDGDGGVN TASVLLGAGV CLSLIAQIGE       240
     QIDYLRFMPP KTEANKRGWW TAVIMAGPGW VVLGALKQAI GVFLAVYILA KVGPAAATEP       300
     IQQFRGAFDA MMPSWMVIPL AVALVVISQI KINVTNAYSG SLAWTNSFTR VTKHYPGRMV       360
     FVLVNLGFAL ALMEADMFSF LNDILGFYSN CAIAWVVTVA TDIGINKYLL KISPLQPEFR       420
     RGMLHAVNPV GVVAFVAASG LSIAMYFHLL GDTLQPYSPV AAAVIAFVLT PLVAIITKGR       480
     YYLRRTDDGI AEPLLDPDGN PSSLTLDCHV CHQSYERPDL TACATHDAVV CSLCLSTDKV       540
     GDHVLPGIA                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page