(data stored in ACNUC7421 zone)

EMBL: CP002047.PE13

CP002047.PE13        Location/Qualifiers
FT   CDS             12126..12479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03134"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV7"
FT                   /protein_id="ADI03134.1"
FT                   /translation="MADSGEGQHLLAERFLDQRQLPGPVTSQGFAEPFGVVLDVALAAG
FT                   SLEGSSDLCSGQVRGFDGGGRQLEELACFGSAQAVGPGGEGVPGVGVVLAQWRPELVGD
FT                   LLPVPGRVLLGAG"
     MADSGEGQHL LAERFLDQRQ LPGPVTSQGF AEPFGVVLDV ALAAGSLEGS SDLCSGQVRG        60
     FDGGGRQLEE LACFGSAQAV GPGGEGVPGV GVVLAQWRPE LVGDLLPVPG RVLLGAG          117
//

If you have problems or comments...

PBIL Back to PBIL home page