(data stored in ACNUC7421 zone)

EMBL: CP002047.PE133

CP002047.PE133       Location/Qualifiers
FT   CDS             128496..129716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00133"
FT                   /product="hypothetical protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03254"
FT                   /db_xref="GOA:D7BUR3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR3"
FT                   /protein_id="ADI03254.1"
FT                   /translation="MSDAVLIGLGSMIGAGIFASLSPAARAAGSGLLLGLALAAVVAYC
FT                   NATSSARLAARYPASGGTYVYGRERLGEFWGYLAGWSFVVGKTASCAAMALTVGTYIWP
FT                   GQTHTVAVAAVVALTAVNYAGVQKSALLTRVIVAVVLPVLAAVVATCLTSGAVAAARLN
FT                   IGSDAAFGGVLQAAGLLFFAFAGYARIATLGEEVRDPVRTIPRAIPVALGLTLVVYTAV
FT                   AVSVLLVLGSDGLAATGAPLTDAARAAGAAWLVPAVRIGAAVAALGSLLALILGVSRTT
FT                   LAMARDHHLPHALASVHPRFKVPHRAELLVGTVVATVAATADVRGAIGFSSFGVLAYYA
FT                   VANASAWTLSPAEGRPARIIPAVGLAGCLVLAFALPVSSVISGAVVLAVGAAAYAVSRA
FT                   SFRSPPA"
     MSDAVLIGLG SMIGAGIFAS LSPAARAAGS GLLLGLALAA VVAYCNATSS ARLAARYPAS        60
     GGTYVYGRER LGEFWGYLAG WSFVVGKTAS CAAMALTVGT YIWPGQTHTV AVAAVVALTA       120
     VNYAGVQKSA LLTRVIVAVV LPVLAAVVAT CLTSGAVAAA RLNIGSDAAF GGVLQAAGLL       180
     FFAFAGYARI ATLGEEVRDP VRTIPRAIPV ALGLTLVVYT AVAVSVLLVL GSDGLAATGA       240
     PLTDAARAAG AAWLVPAVRI GAAVAALGSL LALILGVSRT TLAMARDHHL PHALASVHPR       300
     FKVPHRAELL VGTVVATVAA TADVRGAIGF SSFGVLAYYA VANASAWTLS PAEGRPARII       360
     PAVGLAGCLV LAFALPVSSV ISGAVVLAVG AAAYAVSRAS FRSPPA                      406
//

If you have problems or comments...

PBIL Back to PBIL home page