(data stored in ACNUC7421 zone)

EMBL: CP002047.PE135

CP002047.PE135       Location/Qualifiers
FT   CDS             complement(130850..132256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03256"
FT                   /db_xref="GOA:D7BUR5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR5"
FT                   /protein_id="ADI03256.1"
FT                   /translation="MRAGVFAVLGTVLAAFGHHAIAEGTVPWRLVSCLATAQFAGVWPL
FT                   ARRHCPPAATMLFTLATQGVLHLALSWADGDTQTGTPGHAVHTGHLTAAPGDGHAWHHA
FT                   GTAMTTVHTLAALAVAWLLHRADARMVTALDTLRTLARAAAAALAQALPRPVSGAGRLL
FT                   RLPGRQAWGRDDLPVRAEGEVLKHVVVRRGPPQPERHLPSRAGPDHPRDRSNPWQQGVP
FT                   VPKRPHPPARTARRIALAGAAALTSVLALAAPAAAHAEVEADTPQALAENVTLSFVSEA
FT                   ESDSAGFRELRIVLPDGIASDDVSLADAPKGWRMKATPDGYTVGGPALRPGVNAEHKIK
FT                   VNRLPDAKEIAFKTVETYSDGQVSRWIELPRGGGEPEQPAPVLKLKAAAADAKPVSPSP
FT                   TSSPAPDETSSATADSTSEQDATSAEEKATGESDSVSSGVLIWVIVAVLLVLAGGVWWL
FT                   IRRRVSASQR"
     MRAGVFAVLG TVLAAFGHHA IAEGTVPWRL VSCLATAQFA GVWPLARRHC PPAATMLFTL        60
     ATQGVLHLAL SWADGDTQTG TPGHAVHTGH LTAAPGDGHA WHHAGTAMTT VHTLAALAVA       120
     WLLHRADARM VTALDTLRTL ARAAAAALAQ ALPRPVSGAG RLLRLPGRQA WGRDDLPVRA       180
     EGEVLKHVVV RRGPPQPERH LPSRAGPDHP RDRSNPWQQG VPVPKRPHPP ARTARRIALA       240
     GAAALTSVLA LAAPAAAHAE VEADTPQALA ENVTLSFVSE AESDSAGFRE LRIVLPDGIA       300
     SDDVSLADAP KGWRMKATPD GYTVGGPALR PGVNAEHKIK VNRLPDAKEI AFKTVETYSD       360
     GQVSRWIELP RGGGEPEQPA PVLKLKAAAA DAKPVSPSPT SSPAPDETSS ATADSTSEQD       420
     ATSAEEKATG ESDSVSSGVL IWVIVAVLLV LAGGVWWLIR RRVSASQR                    468
//

If you have problems or comments...

PBIL Back to PBIL home page