(data stored in ACNUC7421 zone)

EMBL: CP002047.PE136

CP002047.PE136       Location/Qualifiers
FT   CDS             132914..135370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03257"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR6"
FT                   /protein_id="ADI03257.1"
FT                   /translation="MDRRPGGAGTDDLTFVVEYFVRPLVRVFRTALDSYGLVFADPLGP
FT                   DTAFELRADLAATGRVLVMDSLSVSGAAGLMTRRAATLRAARESDTDLGALTAWSSGNA
FT                   AATVPNTLHALAEAFSRARPDAPKDPGAAFREVLAAEMRYLRPDTARLLSADASWAAWA
FT                   HSVPEQQERALAHLLAKLQDRARECRVLPDKPLPVVLIGPLTGGGERALPGLPQLCRDV
FT                   WHAGGETVFLTEGPGCPAAGYASGLARYGVPDPTVLTPRSADGAGPAAAAAALARWDRR
FT                   AEVVACLAVLGPTARAPVGWEAFGRQFPGATLLVVGHDDRTGSGGDDRTWSGDVPMPSS
FT                   LAPQVPDRPDVVQALEMQSPAAAPANTTAAPTLPAARSLSSLRLDVLRHNPAIEQHAVR
FT                   WSGEETRRFVDHLVTAARRNADRTARAARDTLGRRLVGAPTDAERAVRLMHHILQRKQF
FT                   KHGPSSNYPPELALREMLPFVRRGEPVPMAMVFFPNKFAHSKLKAVGDLPDLAELAMLI
FT                   RLLELMEAVHQVYSPGLFFFLAADNQHYRAHSAAKLEEGMLIMSRYAGAAGLSGKVVEI
FT                   VAYDELAERHQGTAFVTAHRALRARILAEYRAALRGLDITSGPLRTLREADLRDPRGNF
FT                   ADLFRSLVFSVRTPGTPGTPGTVPATGSWWSEVYADLYNLAEDCAAPEVIAARKEVLTT
FT                   AWDDALRYVATWHADAHTGYRSKLVPGGVQVSLRPAPGRIGLNLLGGTALSSAHATGAI
FT                   DTRGVVSREFAVALRDQCFVPLYSPLLGPQQPFAMVPVTATQARGDGAGARIDPAFLRT
FT                   TRLRRR"
     MDRRPGGAGT DDLTFVVEYF VRPLVRVFRT ALDSYGLVFA DPLGPDTAFE LRADLAATGR        60
     VLVMDSLSVS GAAGLMTRRA ATLRAARESD TDLGALTAWS SGNAAATVPN TLHALAEAFS       120
     RARPDAPKDP GAAFREVLAA EMRYLRPDTA RLLSADASWA AWAHSVPEQQ ERALAHLLAK       180
     LQDRARECRV LPDKPLPVVL IGPLTGGGER ALPGLPQLCR DVWHAGGETV FLTEGPGCPA       240
     AGYASGLARY GVPDPTVLTP RSADGAGPAA AAAALARWDR RAEVVACLAV LGPTARAPVG       300
     WEAFGRQFPG ATLLVVGHDD RTGSGGDDRT WSGDVPMPSS LAPQVPDRPD VVQALEMQSP       360
     AAAPANTTAA PTLPAARSLS SLRLDVLRHN PAIEQHAVRW SGEETRRFVD HLVTAARRNA       420
     DRTARAARDT LGRRLVGAPT DAERAVRLMH HILQRKQFKH GPSSNYPPEL ALREMLPFVR       480
     RGEPVPMAMV FFPNKFAHSK LKAVGDLPDL AELAMLIRLL ELMEAVHQVY SPGLFFFLAA       540
     DNQHYRAHSA AKLEEGMLIM SRYAGAAGLS GKVVEIVAYD ELAERHQGTA FVTAHRALRA       600
     RILAEYRAAL RGLDITSGPL RTLREADLRD PRGNFADLFR SLVFSVRTPG TPGTPGTVPA       660
     TGSWWSEVYA DLYNLAEDCA APEVIAARKE VLTTAWDDAL RYVATWHADA HTGYRSKLVP       720
     GGVQVSLRPA PGRIGLNLLG GTALSSAHAT GAIDTRGVVS REFAVALRDQ CFVPLYSPLL       780
     GPQQPFAMVP VTATQARGDG AGARIDPAFL RTTRLRRR                               818
//

If you have problems or comments...

PBIL Back to PBIL home page