(data stored in ACNUC7421 zone)

EMBL: CP002047.PE140

CP002047.PE140       Location/Qualifiers
FT   CDS             complement(142265..148906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00140"
FT                   /product="amino acid adenylation domain-containing protein"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03261"
FT                   /db_xref="GOA:D7BUS0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS0"
FT                   /protein_id="ADI03261.1"
FT                   /translation="MDQRPLSFSQEALWFLCRLQPDSPFYNMSRGYRLCGTLERQALEK
FT                   AFADVVRRHAILRTRIVERDDRPELVVDPPLSRWTFETADVRGLPTLQRQAEVSRLNLE
FT                   LARRPFDLAHDLPVRARLMRLDESQHVLHVVFHHIVADRWSLDRVLAPELAERYAAHLA
FT                   GDAAPMPELTTQYWDFARRQREELTEERRRSQRRYWWDSLIGAPAVLEVPGDRPRPPTR
FT                   AYRGETYAFSLPDSLAKGAHELSRQGRTTMFMTMLTAFAGAVAQSSGTEDLIIGVPVMS
FT                   RGRFDHPELIGMFVNTLPLRIDLRGGPPALTVLKRVRSAVLGALGNGELPFEQIVAGLD
FT                   IDRDLSRNPLIQIVFQFEDVPPGARFTEPGVFAGPVGVSSRSIRFDIELHMWLRPDGGV
FT                   SGKAAYATDLYDRDTIAALVRRIERVLGAMVASPDQPLPGVAATCDRRPSHGSATSVPR
FT                   VRRLGDQPDAAASAPESVARPLTPAERLVLDVWQEVLDVTGIRPGDNFFHIGGSSLRAT
FT                   RVAARLRRRLDLEVPLRLLFQHRTAEKLAAALPAAPKAAGGELTGISRPAMPPLSFGQE
FT                   RLWFLDQLVPGSTAYVMGTGFRLVGDLDPVVLRRALDELVRRHEVLRTSFPLDASGRPW
FT                   QSVASATSATPIALPVVEVAQATDEGITDQDITDEDITNTVVRLARERVEEGFPLASGP
FT                   LLRATLFRFTPRLHALVLHIHHSVCDAVSLNLIAREISALYTAFVQGVPSALPEPPLQY
FT                   ADYATWQRQPAQVAEAEREIAHWRRRLAGLTPLDLPTDRPRPAMQSLTGGRYSFNLPQD
FT                   LTRAMARSGEGEGCTPYLVMLAAWAALLARYCDQDDVCVATPVDNRTRPELEQLVGFFA
FT                   DTVVMRIDLGGDPSFRELLHRVRDTFLEAHEHRNVPFERLVAELPVEQDASRNPLAQVA
FT                   LVLHDDRVPAIGLGPVRAEPFGLSNPATRFDLELHMRIEADRTRCLLTYAADLFDEQTV
FT                   ARMARHLVNLLGAAVADAERPVSRLELLAPEERHELLVSFNDTDLDLGAFTALHELVEE
FT                   QVRRSPDAPAVVFGDRVLSYSALDADADRLAAHLRDLGAGAERIVAVCLERSFGLVTAL
FT                   LATLKSGAAFMPLSPDDPPGRLAALLGDASPAVLVTSESLRRRLPVDLPVDLPVVVVDA
FT                   VRVEEPRPPAPRTAVEPRRMAYVLYTSGSTGKPNGAVNTHEGIVNRLRWMQTQFPLDAG
FT                   DAVLQKTPVTFDVCVWEFFWPLISGARLVLAEPGGHRDPDYLARVIREQRITTVHFVPS
FT                   MLHLFLARPGVEEATASLRRVLCSGEALDPGLQERCGRRIAADLYNLYGPAEAAVDVAF
FT                   WRCRRGPRPDTVPIGHPIANTRLYVVDRHLQPVPAGVPGELCIGGVGVGRGYLGRDTLT
FT                   ELRFPPDPFRPGPGRRLFRTGDRARHRPDGALEFLGRRDDQVKLRGVRMELGEIEAALT
FT                   AHPAVEAAAVAVRADTPGGPRLVAYAVPEPRRAGVPRRLAGMDRTGRAVGQHRTVLPDG
FT                   TPVFHRHGEETAFMYGEIFTARTYAPPGVRLPDRAVVFDIGANIGLFSLFAHRDCRDPL
FT                   VYAFEPVPQVCDILRLNAELHGIDAQVFDKALGDRPGTAEFTFYPGVSMLSGRYADSPL
FT                   DRQRVRTIASRDLGSAVSGRDVEDILDARLGATRMARPVITLSSVIEEQGIARIDLLKI
FT                   DVERGELDVLAGIADGHWPLIRRIVIEVDDADGRLAAVLDLLRSRGYTAAVDDGTGQAA
FT                   ADGLRVVHASREAAGPREPAGPRGTAGCDGPGTDSGREDEAGRLLGEGHGGPEERYTSP
FT                   DRLAGDLLAFLRHRLPLPMVPSSLVFLDELPLSPNGKTDRRRLPAPGDGPEQRGAVSPR
FT                   DDTERALAELAEGLLGVSPVGVTDDFFTLGGHSILAAQLMARVETAFGRRPSLAAFLRE
FT                   PTVEQLAGSLRADRSPDPASDGVVRLRAGTGDQPPLFLFAPLGGGVLCYRDLVRHLPPG
FT                   PAVYGLRAPGLDEGTSPEDDLARLAARQAAVVRRVWPTGPYRLAGWSFGGVVAFGVACE
FT                   LVREGARVEPPVLIDSYPVVEPATAGRRAAEFVATFVRERGPSAPPTPRRSAGTKDNDQ
FT                   LGWIISRMREIGVPPREIDDEEIARYWRVFDAAARAAERHRPTRFPGPLLLLRPRRPGR
FT                   PQAGAAGGWGTLADGGVEVRRVPGDHFTVLGADAAAELGRILTG"
     MDQRPLSFSQ EALWFLCRLQ PDSPFYNMSR GYRLCGTLER QALEKAFADV VRRHAILRTR        60
     IVERDDRPEL VVDPPLSRWT FETADVRGLP TLQRQAEVSR LNLELARRPF DLAHDLPVRA       120
     RLMRLDESQH VLHVVFHHIV ADRWSLDRVL APELAERYAA HLAGDAAPMP ELTTQYWDFA       180
     RRQREELTEE RRRSQRRYWW DSLIGAPAVL EVPGDRPRPP TRAYRGETYA FSLPDSLAKG       240
     AHELSRQGRT TMFMTMLTAF AGAVAQSSGT EDLIIGVPVM SRGRFDHPEL IGMFVNTLPL       300
     RIDLRGGPPA LTVLKRVRSA VLGALGNGEL PFEQIVAGLD IDRDLSRNPL IQIVFQFEDV       360
     PPGARFTEPG VFAGPVGVSS RSIRFDIELH MWLRPDGGVS GKAAYATDLY DRDTIAALVR       420
     RIERVLGAMV ASPDQPLPGV AATCDRRPSH GSATSVPRVR RLGDQPDAAA SAPESVARPL       480
     TPAERLVLDV WQEVLDVTGI RPGDNFFHIG GSSLRATRVA ARLRRRLDLE VPLRLLFQHR       540
     TAEKLAAALP AAPKAAGGEL TGISRPAMPP LSFGQERLWF LDQLVPGSTA YVMGTGFRLV       600
     GDLDPVVLRR ALDELVRRHE VLRTSFPLDA SGRPWQSVAS ATSATPIALP VVEVAQATDE       660
     GITDQDITDE DITNTVVRLA RERVEEGFPL ASGPLLRATL FRFTPRLHAL VLHIHHSVCD       720
     AVSLNLIARE ISALYTAFVQ GVPSALPEPP LQYADYATWQ RQPAQVAEAE REIAHWRRRL       780
     AGLTPLDLPT DRPRPAMQSL TGGRYSFNLP QDLTRAMARS GEGEGCTPYL VMLAAWAALL       840
     ARYCDQDDVC VATPVDNRTR PELEQLVGFF ADTVVMRIDL GGDPSFRELL HRVRDTFLEA       900
     HEHRNVPFER LVAELPVEQD ASRNPLAQVA LVLHDDRVPA IGLGPVRAEP FGLSNPATRF       960
     DLELHMRIEA DRTRCLLTYA ADLFDEQTVA RMARHLVNLL GAAVADAERP VSRLELLAPE      1020
     ERHELLVSFN DTDLDLGAFT ALHELVEEQV RRSPDAPAVV FGDRVLSYSA LDADADRLAA      1080
     HLRDLGAGAE RIVAVCLERS FGLVTALLAT LKSGAAFMPL SPDDPPGRLA ALLGDASPAV      1140
     LVTSESLRRR LPVDLPVDLP VVVVDAVRVE EPRPPAPRTA VEPRRMAYVL YTSGSTGKPN      1200
     GAVNTHEGIV NRLRWMQTQF PLDAGDAVLQ KTPVTFDVCV WEFFWPLISG ARLVLAEPGG      1260
     HRDPDYLARV IREQRITTVH FVPSMLHLFL ARPGVEEATA SLRRVLCSGE ALDPGLQERC      1320
     GRRIAADLYN LYGPAEAAVD VAFWRCRRGP RPDTVPIGHP IANTRLYVVD RHLQPVPAGV      1380
     PGELCIGGVG VGRGYLGRDT LTELRFPPDP FRPGPGRRLF RTGDRARHRP DGALEFLGRR      1440
     DDQVKLRGVR MELGEIEAAL TAHPAVEAAA VAVRADTPGG PRLVAYAVPE PRRAGVPRRL      1500
     AGMDRTGRAV GQHRTVLPDG TPVFHRHGEE TAFMYGEIFT ARTYAPPGVR LPDRAVVFDI      1560
     GANIGLFSLF AHRDCRDPLV YAFEPVPQVC DILRLNAELH GIDAQVFDKA LGDRPGTAEF      1620
     TFYPGVSMLS GRYADSPLDR QRVRTIASRD LGSAVSGRDV EDILDARLGA TRMARPVITL      1680
     SSVIEEQGIA RIDLLKIDVE RGELDVLAGI ADGHWPLIRR IVIEVDDADG RLAAVLDLLR      1740
     SRGYTAAVDD GTGQAAADGL RVVHASREAA GPREPAGPRG TAGCDGPGTD SGREDEAGRL      1800
     LGEGHGGPEE RYTSPDRLAG DLLAFLRHRL PLPMVPSSLV FLDELPLSPN GKTDRRRLPA      1860
     PGDGPEQRGA VSPRDDTERA LAELAEGLLG VSPVGVTDDF FTLGGHSILA AQLMARVETA      1920
     FGRRPSLAAF LREPTVEQLA GSLRADRSPD PASDGVVRLR AGTGDQPPLF LFAPLGGGVL      1980
     CYRDLVRHLP PGPAVYGLRA PGLDEGTSPE DDLARLAARQ AAVVRRVWPT GPYRLAGWSF      2040
     GGVVAFGVAC ELVREGARVE PPVLIDSYPV VEPATAGRRA AEFVATFVRE RGPSAPPTPR      2100
     RSAGTKDNDQ LGWIISRMRE IGVPPREIDD EEIARYWRVF DAAARAAERH RPTRFPGPLL      2160
     LLRPRRPGRP QAGAAGGWGT LADGGVEVRR VPGDHFTVLG ADAAAELGRI LTG             2213
//

If you have problems or comments...

PBIL Back to PBIL home page