(data stored in ACNUC7421 zone)

EMBL: CP002047.PE141

CP002047.PE141       Location/Qualifiers
FT   CDS             149111..149926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00141"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /note="COG3208 Predicted thioesterase involved in
FT                   non-ribosomal peptide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03262"
FT                   /db_xref="GOA:D7BUS1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS1"
FT                   /protein_id="ADI03262.1"
FT                   /translation="MLPLDVELWAVQLPGREDRFVEPPQTCFETLVDELADAIAPHTAD
FT                   TPFALFGHSGGALLAFELARALRKREQPAPTRLFLSAEPPPDVPRSATKLHTLDDAELI
FT                   RQLRARGGTPPEIAENEELMELLLPVLRADFTWYETYEYQPGPQLESPVTAFVGHDDPI
FT                   VGAEAVSGWRSHTTGSFEARGVTGGHFFVRDAMEEIVSHVARALLPPALESVGPSPRRR
FT                   PQREERPRCRTAPMSAYSTSCVESCAWTPSTCARTSSIWQRPLCPSCRS"
     MLPLDVELWA VQLPGREDRF VEPPQTCFET LVDELADAIA PHTADTPFAL FGHSGGALLA        60
     FELARALRKR EQPAPTRLFL SAEPPPDVPR SATKLHTLDD AELIRQLRAR GGTPPEIAEN       120
     EELMELLLPV LRADFTWYET YEYQPGPQLE SPVTAFVGHD DPIVGAEAVS GWRSHTTGSF       180
     EARGVTGGHF FVRDAMEEIV SHVARALLPP ALESVGPSPR RRPQREERPR CRTAPMSAYS       240
     TSCVESCAWT PSTCARTSSI WQRPLCPSCR S                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page