(data stored in ACNUC7421 zone)

EMBL: CP002047.PE142

CP002047.PE142       Location/Qualifiers
FT   CDS             150477..152234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00142"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03263"
FT                   /db_xref="GOA:D7BUS2"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS2"
FT                   /protein_id="ADI03263.1"
FT                   /translation="MRLVPGVDIDHRGTPFTEDLLRQLLRALSDPSTGKPQMGTAKFSG
FT                   ARFTGNAEFDKAQFSGDAEFDEAQFTGYAVFHGAQFSGNAQFHRTQFSDYAGFRMVQFS
FT                   GYAEFGGAQFHDNAEFDEAHFPGNAGFDGAQFSGHIRFGSARFSGYAGFDGAQFSGGAV
FT                   FGEAQFSGRARFRRARFSGYAGFDEARFYGETEFGGAQFASSAGFGRARFVVASELGPF
FT                   VCAGVVDLSRAVFEDPVTLEIAARKVLCKRTRWESTATVRLRYATADFEDAVLSAPVAV
FT                   TAHPTCFATGDDAVEKSLLSDGCDGVRVTSVQGVDAAHLVLIDADLTDCLFFGAFHLDQ
FT                   IHLEGHTVFAPTPTGWHRRGIRPTRWTRRRTLAEEHHCRAATTAPDDPRQWRPRPHLAP
FT                   GSTPKPQDVAALYRQLRKALEDGKNEPGAADFYYGECEMRRHDRTATPKGERRILWGYW
FT                   LLSGYGLRASRAFTWLFAAMSLTVLLLMGVGLPTHDPDPATTGTLHGNQISLSTSTPDP
FT                   AALHGTWSQRMTWARAEQATRAAVNSVIFRSSGQNLTSAGTYIEMVSRLLEPTLIALGA
FT                   LAIRGRIKR"
     MRLVPGVDID HRGTPFTEDL LRQLLRALSD PSTGKPQMGT AKFSGARFTG NAEFDKAQFS        60
     GDAEFDEAQF TGYAVFHGAQ FSGNAQFHRT QFSDYAGFRM VQFSGYAEFG GAQFHDNAEF       120
     DEAHFPGNAG FDGAQFSGHI RFGSARFSGY AGFDGAQFSG GAVFGEAQFS GRARFRRARF       180
     SGYAGFDEAR FYGETEFGGA QFASSAGFGR ARFVVASELG PFVCAGVVDL SRAVFEDPVT       240
     LEIAARKVLC KRTRWESTAT VRLRYATADF EDAVLSAPVA VTAHPTCFAT GDDAVEKSLL       300
     SDGCDGVRVT SVQGVDAAHL VLIDADLTDC LFFGAFHLDQ IHLEGHTVFA PTPTGWHRRG       360
     IRPTRWTRRR TLAEEHHCRA ATTAPDDPRQ WRPRPHLAPG STPKPQDVAA LYRQLRKALE       420
     DGKNEPGAAD FYYGECEMRR HDRTATPKGE RRILWGYWLL SGYGLRASRA FTWLFAAMSL       480
     TVLLLMGVGL PTHDPDPATT GTLHGNQISL STSTPDPAAL HGTWSQRMTW ARAEQATRAA       540
     VNSVIFRSSG QNLTSAGTYI EMVSRLLEPT LIALGALAIR GRIKR                       585
//

If you have problems or comments...

PBIL Back to PBIL home page