(data stored in ACNUC7421 zone)

EMBL: CP002047.PE143

CP002047.PE143       Location/Qualifiers
FT   CDS             complement(152363..152773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00143"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03264"
FT                   /db_xref="GOA:D7BUS3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS3"
FT                   /protein_id="ADI03264.1"
FT                   /translation="MPANATAHVRTARPSHDLQAAERFWVSGLGLDVLYRHTSDGTPGD
FT                   HSLLMVGWPHAAWHLELTRDPHAPVAPRPTPEDLFVIYLGEPVPESLVERLEQHGGKRV
FT                   PAHNPYWDTWGVTIQDPDGYLLVLSTRSWSNS"
     MPANATAHVR TARPSHDLQA AERFWVSGLG LDVLYRHTSD GTPGDHSLLM VGWPHAAWHL        60
     ELTRDPHAPV APRPTPEDLF VIYLGEPVPE SLVERLEQHG GKRVPAHNPY WDTWGVTIQD       120
     PDGYLLVLST RSWSNS                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page