(data stored in ACNUC7421 zone)

EMBL: CP002047.PE144

CP002047.PE144       Location/Qualifiers
FT   CDS             complement(152995..153594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00144"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03265"
FT                   /db_xref="GOA:D7BUS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS4"
FT                   /protein_id="ADI03265.1"
FT                   /translation="MLRTSDAESFSVRKLAAALGTDSSSLYRHFRNKTELLRAVADRIL
FT                   MAAMDGYHPEGDWKQRITALALRLREAFGRQPQLAAIWGRYASSGTGSRLVMEEVLQAL
FT                   RASGLPDEEIPARYHRIVILLAALIASETGVSTITPEEYEQGMELFRVAVLGADPERFP
FT                   ALSHFARDIRPLGADRRAAFEDILVAQLAHIEAGIP"
     MLRTSDAESF SVRKLAAALG TDSSSLYRHF RNKTELLRAV ADRILMAAMD GYHPEGDWKQ        60
     RITALALRLR EAFGRQPQLA AIWGRYASSG TGSRLVMEEV LQALRASGLP DEEIPARYHR       120
     IVILLAALIA SETGVSTITP EEYEQGMELF RVAVLGADPE RFPALSHFAR DIRPLGADRR       180
     AAFEDILVAQ LAHIEAGIP                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page