(data stored in ACNUC7421 zone)

EMBL: CP002047.PE145

CP002047.PE145       Location/Qualifiers
FT   CDS             153847..154830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00145"
FT                   /product="Esterase/lipase-like protein"
FT                   /note="COG0657 Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03266"
FT                   /db_xref="GOA:D7BUS5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS5"
FT                   /protein_id="ADI03266.1"
FT                   /translation="MSEATAAKRPPEPDFSVITAEELVAYRDAENRFRASSAARAITGD
FT                   PDPGAAIEWQEVSLPGRELPVRVYRPMAENGGRGADRAELPLVLHVHGGSFVGTAVQSD
FT                   WVNSHLAAQLPALVVSVEHRLLDQETPLSAAADDGWDVLQHVIRHAAQWGIDPARTAVF
FT                   GESCGALICALAAIRAREAGLQLEAQVLVNPAVEVTETMFDYASITEYGYSPTRAMPQL
FT                   RLFQRLSVPPGTDTRALSPLYADNLNGLAPALLVVPTQDAVADHGRRYAERLRAAGTSV
FT                   RLTEYPGARHAFLSMPGVAPQAEAARTEILEFLRVALGAGPEREAI"
     MSEATAAKRP PEPDFSVITA EELVAYRDAE NRFRASSAAR AITGDPDPGA AIEWQEVSLP        60
     GRELPVRVYR PMAENGGRGA DRAELPLVLH VHGGSFVGTA VQSDWVNSHL AAQLPALVVS       120
     VEHRLLDQET PLSAAADDGW DVLQHVIRHA AQWGIDPART AVFGESCGAL ICALAAIRAR       180
     EAGLQLEAQV LVNPAVEVTE TMFDYASITE YGYSPTRAMP QLRLFQRLSV PPGTDTRALS       240
     PLYADNLNGL APALLVVPTQ DAVADHGRRY AERLRAAGTS VRLTEYPGAR HAFLSMPGVA       300
     PQAEAARTEI LEFLRVALGA GPEREAI                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page