(data stored in ACNUC7421 zone)

EMBL: CP002047.PE146

CP002047.PE146       Location/Qualifiers
FT   CDS             154830..155279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00146"
FT                   /product="hypothetical protein"
FT                   /note="COG0469 Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03267"
FT                   /db_xref="GOA:D7BUS6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS6"
FT                   /protein_id="ADI03267.1"
FT                   /translation="MTKTRHERLAVAAMYTGLGLTVIATIVPYLDRATTHLLADHVRAG
FT                   YPTYSQTRVDTAVTTYLVLLSAIGAFGVIAWLGTAWAVKTGNRWARPAATLMFILGTSV
FT                   GLTGLLTKDTSGETGLPPALGWAGIAPCLAGLLAVALLWRRPRPA"
     MTKTRHERLA VAAMYTGLGL TVIATIVPYL DRATTHLLAD HVRAGYPTYS QTRVDTAVTT        60
     YLVLLSAIGA FGVIAWLGTA WAVKTGNRWA RPAATLMFIL GTSVGLTGLL TKDTSGETGL       120
     PPALGWAGIA PCLAGLLAVA LLWRRPRPA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page