(data stored in ACNUC7421 zone)

EMBL: CP002047.PE147

CP002047.PE147       Location/Qualifiers
FT   CDS             complement(155338..155745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03268"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS7"
FT                   /protein_id="ADI03268.1"
FT                   /translation="MNSFQMGSWQATLELAEINAPHGFMRYYRSDITAAMAGSPSSWKA
FT                   TQYLMGNHTITERMFRHDPSVMLHAPLRTLLYADPDGDTKLAVDQPSLLFASYDNSRIA
FT                   DVRRELDALLAGLVTLLGGDAPPQLTSRARS"
     MNSFQMGSWQ ATLELAEINA PHGFMRYYRS DITAAMAGSP SSWKATQYLM GNHTITERMF        60
     RHDPSVMLHA PLRTLLYADP DGDTKLAVDQ PSLLFASYDN SRIADVRREL DALLAGLVTL       120
     LGGDAPPQLT SRARS                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page