(data stored in ACNUC7421 zone)

EMBL: CP002047.PE156

CP002047.PE156       Location/Qualifiers
FT   CDS             complement(175589..176128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00156"
FT                   /product="hypothetical protein"
FT                   /note="COG2847 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03277"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT6"
FT                   /protein_id="ADI03277.1"
FT                   /translation="MGGDSVMARPADGIRVPSPGTDRTPWRPLRAAAVPLLACLLTLGT
FT                   LVAWTTTGRAGTPAVLSVRDGRVFVPQNPEATAAFFTIDNSGGSDDRLIGVTAPAGGRA
FT                   MLSRRVVTGKGMHGMEMVSAVTVPAGGTLRMTANTVDVMIKPPPRIAPGDRLTFTLHFR
FT                   ASPPVTTRALAVRPGR"
     MGGDSVMARP ADGIRVPSPG TDRTPWRPLR AAAVPLLACL LTLGTLVAWT TTGRAGTPAV        60
     LSVRDGRVFV PQNPEATAAF FTIDNSGGSD DRLIGVTAPA GGRAMLSRRV VTGKGMHGME       120
     MVSAVTVPAG GTLRMTANTV DVMIKPPPRI APGDRLTFTL HFRASPPVTT RALAVRPGR        179
//

If you have problems or comments...

PBIL Back to PBIL home page