(data stored in ACNUC7421 zone)

EMBL: CP002047.PE159

CP002047.PE159       Location/Qualifiers
FT   CDS             complement(179233..181191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03280"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT9"
FT                   /protein_id="ADI03280.1"
FT                   /translation="MRRSSRPLAAVIAFLTLLGLLLLPGATAAGAAPAGGAGPLPSVVP
FT                   RPQAMARLGPDVTVPAEVRVVYGDEVDRPTRDLVASVLRRAGAKRLRGGSGPGLTVTVG
FT                   RLADARVAEALRAAGGRVPEELPAEGYALAASGTAVALAGADADGTYYAAQTLRQLVTG
FT                   ARTIASVSIVDHPLMPLRGVIEGFYGSPWTHAERMDQLAFYGDVKMNTYVYAPKDDPYH
FT                   REKWREPYPADKLAQLGELVRQAADHHVRFTFALSPGTSLCYSDPADFTALQAKLGAMY
FT                   DLGVRSFSVPLDDISYTRWNCAADRTAYGEPSQRTAAQAQADLLNRVQKEFLDAREGTS
FT                   PLQTVPTEYGDVTDTAYKRTLRERLDARVEVMWTGTDVVPPRITVADAARAAAVWGRKV
FT                   FVWDNYPVNDYGQAEGRLLLAPYDAREPGLHQQLSGLVLNPMNQAAASKVALFGGADFA
FT                   WNDTGYDPDRTWRAAAAYLAGDNPDAATAPALLSFFDTQHLAPTFGAEPWQSQAPELAA
FT                   RLARFRTDWDAGRQRAALEALRPTAALLATASATIRAGVADRGFVADCAPWLDALALWG
FT                   RAFERTLDALGARLDGNTQQAEQRFAEASSLAGQAGRIRTIPGETRPEGPVRVADGVLD
FT                   TFLAAAPGLGGAGAHAP"
     MRRSSRPLAA VIAFLTLLGL LLLPGATAAG AAPAGGAGPL PSVVPRPQAM ARLGPDVTVP        60
     AEVRVVYGDE VDRPTRDLVA SVLRRAGAKR LRGGSGPGLT VTVGRLADAR VAEALRAAGG       120
     RVPEELPAEG YALAASGTAV ALAGADADGT YYAAQTLRQL VTGARTIASV SIVDHPLMPL       180
     RGVIEGFYGS PWTHAERMDQ LAFYGDVKMN TYVYAPKDDP YHREKWREPY PADKLAQLGE       240
     LVRQAADHHV RFTFALSPGT SLCYSDPADF TALQAKLGAM YDLGVRSFSV PLDDISYTRW       300
     NCAADRTAYG EPSQRTAAQA QADLLNRVQK EFLDAREGTS PLQTVPTEYG DVTDTAYKRT       360
     LRERLDARVE VMWTGTDVVP PRITVADAAR AAAVWGRKVF VWDNYPVNDY GQAEGRLLLA       420
     PYDAREPGLH QQLSGLVLNP MNQAAASKVA LFGGADFAWN DTGYDPDRTW RAAAAYLAGD       480
     NPDAATAPAL LSFFDTQHLA PTFGAEPWQS QAPELAARLA RFRTDWDAGR QRAALEALRP       540
     TAALLATASA TIRAGVADRG FVADCAPWLD ALALWGRAFE RTLDALGARL DGNTQQAEQR       600
     FAEASSLAGQ AGRIRTIPGE TRPEGPVRVA DGVLDTFLAA APGLGGAGAH AP               652
//

If you have problems or comments...

PBIL Back to PBIL home page