(data stored in ACNUC7421 zone)

EMBL: CP002047.PE161

CP002047.PE161       Location/Qualifiers
FT   CDS             complement(181586..181723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03282"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU1"
FT                   /protein_id="ADI03282.1"
FT                   /translation="MLGYIAARTEKLVLSANGRPADVPDAPTHPARVAAAVSAEGETVA
FT                   "
     MLGYIAARTE KLVLSANGRP ADVPDAPTHP ARVAAAVSAE GETVA                        45
//

If you have problems or comments...

PBIL Back to PBIL home page