(data stored in ACNUC7421 zone)

EMBL: CP002047.PE163

CP002047.PE163       Location/Qualifiers
FT   CDS             182039..182191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00163"
FT                   /product="hypothetical protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03284"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU3"
FT                   /protein_id="ADI03284.1"
FT                   /translation="MTDDVLDVWKGLARNVRGVPIPQCGHLCQEERPDAVSTELRFLFL
FT                   ADRDG"
     MTDDVLDVWK GLARNVRGVP IPQCGHLCQE ERPDAVSTEL RFLFLADRDG                   50
//

If you have problems or comments...

PBIL Back to PBIL home page