(data stored in ACNUC7421 zone)

EMBL: CP002047.PE165

CP002047.PE165       Location/Qualifiers
FT   CDS             complement(182633..182749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU5"
FT                   /protein_id="ADI03286.1"
FT                   /translation="MSRCLRARAEREGAELPYPWSAERGGRRLAPQPDSEAY"
     MSRCLRARAE REGAELPYPW SAERGGRRLA PQPDSEAY                                38
//

If you have problems or comments...

PBIL Back to PBIL home page