(data stored in ACNUC7421 zone)

EMBL: CP002047.PE166

CP002047.PE166       Location/Qualifiers
FT   CDS             183795..184073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03287"
FT                   /db_xref="GOA:D7BUU6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU6"
FT                   /protein_id="ADI03287.1"
FT                   /translation="MYDVVSVAGIAVLVVGVLAIAAIVRSGSFIPNVRWRTCAECGHRP
FT                   SEHSINKSRCLAVVGGSGDRYDSGGDWIGWWNETYCDCSGYREQKTQ"
     MYDVVSVAGI AVLVVGVLAI AAIVRSGSFI PNVRWRTCAE CGHRPSEHSI NKSRCLAVVG        60
     GSGDRYDSGG DWIGWWNETY CDCSGYREQK TQ                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page