(data stored in ACNUC7421 zone)

EMBL: CP002047.PE167

CP002047.PE167       Location/Qualifiers
FT   CDS             184294..184932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03288"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU7"
FT                   /protein_id="ADI03288.1"
FT                   /translation="MPASFSGIASNRAMGGLVHAMSGGSRLQAWRNKQLVITVYEHGIV
FT                   VGLADDPNPFHFRYDEVTSFVQDLVKRYVNQSYRGTTTTCLVSLNDGRSHRLQGQSTRT
FT                   ERNVVEDFRNLVDPKIAAAQLPGMLAAMRQGRAVAFGAYVLEPSALTTGTGRKHKRLPW
FT                   PQVEQVTLERGLVKVTERGRRGAWATASTSAVPNLTTFLNLVREAQAGV"
     MPASFSGIAS NRAMGGLVHA MSGGSRLQAW RNKQLVITVY EHGIVVGLAD DPNPFHFRYD        60
     EVTSFVQDLV KRYVNQSYRG TTTTCLVSLN DGRSHRLQGQ STRTERNVVE DFRNLVDPKI       120
     AAAQLPGMLA AMRQGRAVAF GAYVLEPSAL TTGTGRKHKR LPWPQVEQVT LERGLVKVTE       180
     RGRRGAWATA STSAVPNLTT FLNLVREAQA GV                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page