(data stored in ACNUC7421 zone)

EMBL: CP002047.PE168

CP002047.PE168       Location/Qualifiers
FT   CDS             complement(184997..185902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00168"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03289"
FT                   /db_xref="GOA:D7BUU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU8"
FT                   /protein_id="ADI03289.1"
FT                   /translation="MLRVVHQQGTVTAAAEALHLTPSAVSHHMRELARQLKVPLMEPQG
FT                   RGVRLTPAGHLLIDHADALLARWEEAQAELESYRVGMAGPLRIAGFNTAISGLIAPAAG
FT                   RLRHSHPDLLVQVRECDTVASMDLLVAGKVEVAVVEPTEGGPPLDDARFEQSPLLEEPY
FT                   IMLVPADHPLAQAVSVRLEDAAAEDWIVADPGTCDHAQRVRMLCAAAGFSPRIVHAATQ
FT                   WAAVWSLVGNGLGVSLVPRLAEGPAGQAVVRMPVSSENMPTRRILTCVRRGSRRHPLVD
FT                   LGIRTLEEVVRDHRTMDDWP"
     MLRVVHQQGT VTAAAEALHL TPSAVSHHMR ELARQLKVPL MEPQGRGVRL TPAGHLLIDH        60
     ADALLARWEE AQAELESYRV GMAGPLRIAG FNTAISGLIA PAAGRLRHSH PDLLVQVREC       120
     DTVASMDLLV AGKVEVAVVE PTEGGPPLDD ARFEQSPLLE EPYIMLVPAD HPLAQAVSVR       180
     LEDAAAEDWI VADPGTCDHA QRVRMLCAAA GFSPRIVHAA TQWAAVWSLV GNGLGVSLVP       240
     RLAEGPAGQA VVRMPVSSEN MPTRRILTCV RRGSRRHPLV DLGIRTLEEV VRDHRTMDDW       300
     P                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page